HORDB

ID: hor006669
Uniprot ID: Q6IGX9
Protein name: HDC04522
Gene name: SIFa
Organism: Drosophila melanogaster (Fruit fly)
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Strongly expressed in two pairs of neurons in the pars intercerebralis (at protein level).
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007610 behavior; GO:0007621 negative regulation of female receptivity; GO:0042752 regulation of circadian rhythm; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0048047 mating behavior, sex discrimination
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK
Length: 72
Propeptide: MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK
Signal peptide: MALRFTLTLLLVTILVAAILLGSSEA
Modification: T38 Phenylalanine amide
Glycosylation: T34 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Ligand for the neuropeptide SIFamide receptor (PubMed:16378592). Modulates sexual behavior by negatively regulating female receptivity to male courtship and by playing a role in male sex discrimination (PubMed:17126293, PubMed:26469541). Also involved in promoting sleep (PubMed:24658384).
Mechanism: NA
Cross BBB: NA
Target: SIFaR
Target Unid: Q8IN35
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q6IGX9-F1.pdb

hor006669_AF2.pdb

hor006669_ESM.pdb

Mass:	916790	Formula:	C355H564N90O101S6
Absent amino acids:	H	Common amino acids:	AL
pI:	8.21	Basic residues:	7
Polar residues:	20	Hydrophobic residues:	30
Hydrophobicity:	30	Boman Index:	-5028
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	93.61
Instability Index:	6092.5	Extinction Coefficient cystines:	8605
Absorbance 280nm:	121.2

PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 14709175
Title: An integrated gene annotation and transcriptional profiling approach towards the full gene content of the Drosophila genome.
PubMed ID: 15219831
Title: SIFamide is a highly conserved neuropeptide: a comparative study in different insect species.
PubMed ID: 16378592
Title: Molecular identification of the first SIFamide receptor.
PubMed ID: 17126293
Title: The neuropeptide SIFamide modulates sexual behavior in Drosophila.
PubMed ID: 24658384
Title: SIFamide and SIFamide receptor defines a novel neuropeptide signaling to promote sleep in Drosophila.
PubMed ID: 26469541
Title: SIFamide acts on fruitless neurons to modulate sexual behavior in Drosophila melanogaster.