General Information

  • ID:  hor006669
  • Uniprot ID:  Q6IGX9
  • Protein name:  HDC04522
  • Gene name:  SIFa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Strongly expressed in two pairs of neurons in the pars intercerebralis (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007610 behavior; GO:0007621 negative regulation of female receptivity; GO:0042752 regulation of circadian rhythm; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0048047 mating behavior, sex discrimination
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK
  • Length:  72(1-72)
  • Propeptide:  MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK
  • Signal peptide:  MALRFTLTLLLVTILVAAILLGSSEA
  • Modification:  T38 Phenylalanine amide
  • Glycosylation:  T34 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Ligand for the neuropeptide SIFamide receptor (PubMed:16378592). Modulates sexual behavior by negatively regulating female receptivity to male courtship and by playing a role in male sex discrimination (PubMed:17126293, PubMed:26469541). Also involved in
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SIFaR
  • Target Unid:   Q8IN35
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6IGX9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q6IGX9-F1.pdbhor006669_AF2.pdbhor006669_ESM.pdb

Physical Information

Mass: 916790 Formula: C355H564N90O101S6
Absent amino acids: H Common amino acids: AL
pI: 8.21 Basic residues: 7
Polar residues: 20 Hydrophobic residues: 30
Hydrophobicity: 30 Boman Index: -5028
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 93.61
Instability Index: 6092.5 Extinction Coefficient cystines: 8605
Absorbance 280nm: 121.2

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  14709175
  • Title:  An integrated gene annotation and transcriptional profiling approach towards the full gene content of the Drosophila genom
  • PubMed ID:  15219831
  • Title:  
  • PubMed ID:  16378592
  • Title:  
  • PubMed ID:  17126293
  • Title:  
  • PubMed ID:  24658384
  • Title:  
  • PubMed ID:  26469541
  • Title: